| Back to Multiple platform build/check report for BioC 3.22: simplified long |
|
This page was generated on 2026-01-01 11:58 -0500 (Thu, 01 Jan 2026).
| Hostname | OS | Arch (*) | R version | Installed pkgs |
|---|---|---|---|---|
| nebbiolo2 | Linux (Ubuntu 24.04.3 LTS) | x86_64 | 4.5.2 (2025-10-31) -- "[Not] Part in a Rumble" | 4883 |
| taishan | Linux (openEuler 24.03 LTS) | aarch64 | 4.5.0 (2025-04-11) -- "How About a Twenty-Six" | 4671 |
| Click on any hostname to see more info about the system (e.g. compilers) (*) as reported by 'uname -p', except on Windows and Mac OS X | ||||
| Package 1052/2361 | Hostname | OS / Arch | INSTALL | BUILD | CHECK | BUILD BIN | ||||||||
| immunogenViewer 1.4.0 (landing page) Katharina Waury
| nebbiolo2 | Linux (Ubuntu 24.04.3 LTS) / x86_64 | OK | OK | OK | |||||||||
| taishan | Linux (openEuler 24.03 LTS) / aarch64 | OK | OK | OK | ||||||||||
|
To the developers/maintainers of the immunogenViewer package: - Allow up to 24 hours (and sometimes 48 hours) for your latest push to git@git.bioconductor.org:packages/immunogenViewer.git to reflect on this report. See Troubleshooting Build Report for more information. - Use the following Renviron settings to reproduce errors and warnings. - If 'R CMD check' started to fail recently on the Linux builder(s) over a missing dependency, add the missing dependency to 'Suggests:' in your DESCRIPTION file. See Renviron.bioc for more information. |
| Package: immunogenViewer |
| Version: 1.4.0 |
| Command: /home/biocbuild/bbs-3.22-bioc/R/bin/R CMD check --install=check:immunogenViewer.install-out.txt --library=/home/biocbuild/bbs-3.22-bioc/R/site-library --timings immunogenViewer_1.4.0.tar.gz |
| StartedAt: 2025-12-30 00:33:49 -0500 (Tue, 30 Dec 2025) |
| EndedAt: 2025-12-30 00:36:38 -0500 (Tue, 30 Dec 2025) |
| EllapsedTime: 169.2 seconds |
| RetCode: 0 |
| Status: OK |
| CheckDir: immunogenViewer.Rcheck |
| Warnings: 0 |
##############################################################################
##############################################################################
###
### Running command:
###
### /home/biocbuild/bbs-3.22-bioc/R/bin/R CMD check --install=check:immunogenViewer.install-out.txt --library=/home/biocbuild/bbs-3.22-bioc/R/site-library --timings immunogenViewer_1.4.0.tar.gz
###
##############################################################################
##############################################################################
* using log directory ‘/home/biocbuild/bbs-3.22-bioc/meat/immunogenViewer.Rcheck’
* using R version 4.5.2 (2025-10-31)
* using platform: x86_64-pc-linux-gnu
* R was compiled by
gcc (Ubuntu 13.3.0-6ubuntu2~24.04) 13.3.0
GNU Fortran (Ubuntu 13.3.0-6ubuntu2~24.04) 13.3.0
* running under: Ubuntu 24.04.3 LTS
* using session charset: UTF-8
* checking for file ‘immunogenViewer/DESCRIPTION’ ... OK
* checking extension type ... Package
* this is package ‘immunogenViewer’ version ‘1.4.0’
* package encoding: UTF-8
* checking package namespace information ... OK
* checking package dependencies ... OK
* checking if this is a source package ... OK
* checking if there is a namespace ... OK
* checking for hidden files and directories ... OK
* checking for portable file names ... OK
* checking for sufficient/correct file permissions ... OK
* checking whether package ‘immunogenViewer’ can be installed ... OK
* checking installed package size ... OK
* checking package directory ... OK
* checking ‘build’ directory ... OK
* checking DESCRIPTION meta-information ... OK
* checking top-level files ... OK
* checking for left-over files ... OK
* checking index information ... OK
* checking package subdirectories ... OK
* checking code files for non-ASCII characters ... OK
* checking R files for syntax errors ... OK
* checking whether the package can be loaded ... OK
* checking whether the package can be loaded with stated dependencies ... OK
* checking whether the package can be unloaded cleanly ... OK
* checking whether the namespace can be loaded with stated dependencies ... OK
* checking whether the namespace can be unloaded cleanly ... OK
* checking loading without being on the library search path ... OK
* checking dependencies in R code ... NOTE
Namespaces in Imports field not imported from:
‘httr’ ‘jsonlite’
All declared Imports should be used.
* checking S3 generic/method consistency ... OK
* checking replacement functions ... OK
* checking foreign function calls ... OK
* checking R code for possible problems ... NOTE
addImmunogensToPlot: no visible binding for global variable ‘xmin’
addImmunogensToPlot: no visible binding for global variable ‘xmax’
addImmunogensToPlot: no visible binding for global variable ‘ymin’
addImmunogensToPlot: no visible binding for global variable ‘ymax’
addImmunogensToPlot: no visible binding for global variable ‘x’
addImmunogensToPlot: no visible binding for global variable ‘y’
addImmunogensToPlot: no visible binding for global variable ‘label’
plotAccessibility: no visible binding for global variable
‘SolventAccessibility’
plotSecondaryStructure: no visible binding for global variable
‘SecondaryStructure’
plotSinglePositions: no visible binding for global variable ‘Location’
plotSinglePositions: no visible binding for global variable ‘y’
Undefined global functions or variables:
Location SecondaryStructure SolventAccessibility label x xmax xmin y
ymax ymin
* checking Rd files ... OK
* checking Rd metadata ... OK
* checking Rd cross-references ... OK
* checking for missing documentation entries ... OK
* checking for code/documentation mismatches ... OK
* checking Rd \usage sections ... OK
* checking Rd contents ... OK
* checking for unstated dependencies in examples ... OK
* checking files in ‘vignettes’ ... OK
* checking examples ... OK
* checking for unstated dependencies in ‘tests’ ... OK
* checking tests ...
Running ‘testthat.R’
OK
* checking for unstated dependencies in vignettes ... OK
* checking package vignettes ... OK
* checking re-building of vignette outputs ... OK
* checking PDF version of manual ... OK
* DONE
Status: 2 NOTEs
See
‘/home/biocbuild/bbs-3.22-bioc/meat/immunogenViewer.Rcheck/00check.log’
for details.
immunogenViewer.Rcheck/00install.out
############################################################################## ############################################################################## ### ### Running command: ### ### /home/biocbuild/bbs-3.22-bioc/R/bin/R CMD INSTALL immunogenViewer ### ############################################################################## ############################################################################## * installing to library ‘/home/biocbuild/bbs-3.22-bioc/R/site-library’ * installing *source* package ‘immunogenViewer’ ... ** this is package ‘immunogenViewer’ version ‘1.4.0’ ** using staged installation ** R ** inst ** byte-compile and prepare package for lazy loading ** help *** installing help indices ** building package indices ** installing vignettes ** testing if installed package can be loaded from temporary location ** testing if installed package can be loaded from final location ** testing if installed package keeps a record of temporary installation path * DONE (immunogenViewer)
immunogenViewer.Rcheck/tests/testthat.Rout
R version 4.5.2 (2025-10-31) -- "[Not] Part in a Rumble"
Copyright (C) 2025 The R Foundation for Statistical Computing
Platform: x86_64-pc-linux-gnu
R is free software and comes with ABSOLUTELY NO WARRANTY.
You are welcome to redistribute it under certain conditions.
Type 'license()' or 'licence()' for distribution details.
R is a collaborative project with many contributors.
Type 'contributors()' for more information and
'citation()' on how to cite R or R packages in publications.
Type 'demo()' for some demos, 'help()' for on-line help, or
'help.start()' for an HTML browser interface to help.
Type 'q()' to quit R.
> # This file is part of the standard setup for testthat.
> # It is recommended that you do not modify it.
> #
> # Where should you do additional test configuration?
> # Learn more about the roles of various files in:
> # * https://r-pkgs.org/testing-design.html#sec-tests-files-overview
> # * https://testthat.r-lib.org/articles/special-files.html
>
> library(testthat)
> library(immunogenViewer)
>
> test_check("immunogenViewer")
[1] "Immunogen name: A12"
[1] "Immunogen sequence: GHLFAINYTGASMNPARSFGPAVIMGNWENH (Residues 200 - 230)"
[1] "No immunogen specified, evaluating all immunogens."
[1] "Immunogen name: A12"
[1] "Immunogen sequence: GHLFAINYTGASMNPARSFGPAVIMGNWENH (Residues 200 - 230)"
[ FAIL 0 | WARN 0 | SKIP 0 | PASS 39 ]
>
> proc.time()
user system elapsed
10.220 0.964 30.393
immunogenViewer.Rcheck/immunogenViewer-Ex.timings
| name | user | system | elapsed | |
| addImmunogen | 0.189 | 0.009 | 1.608 | |
| addImmunogenList | 0.105 | 0.002 | 2.002 | |
| evaluateImmunogen | 0.159 | 0.088 | 3.078 | |
| getProteinFeatures | 0.088 | 0.023 | 1.583 | |
| plotImmunogen | 1.414 | 0.426 | 3.800 | |
| plotProtein | 1.150 | 0.227 | 2.679 | |
| removeImmunogen | 0.100 | 0.018 | 1.814 | |
| renameImmunogen | 0.114 | 0.016 | 1.895 | |