| Title: | Predict Transmembrane Protein Topology |
| Version: | 1.4 |
| Description: | Proteins reside in either the cell plasma or in the cell membrane. A membrane protein goes through the membrane at least once. Given the amino acid sequence of a membrane protein, the tool 'PureseqTM' (https://github.com/PureseqTM/pureseqTM_package, as described in "Efficient And Accurate Prediction Of Transmembrane Topology From Amino acid sequence only.", Wang, Qing, et al (2019), <doi:10.1101/627307>), can predict the topology of a membrane protein. This package allows one to use 'PureseqTM' from R. |
| License: | GPL-3 |
| Encoding: | UTF-8 |
| RoxygenNote: | 7.2.3 |
| Depends: | R (≥ 3.5.0) |
| Imports: | data.table, devtools, dplyr, ggplot2, Peptides, plyr, rappdirs, readr, stringr, tibble, Rcpp |
| Suggests: | testthat, knitr, markdown, rmarkdown, profvis |
| URL: | https://github.com/richelbilderbeek/pureseqtmr/ |
| BugReports: | https://github.com/richelbilderbeek/pureseqtmr/ |
| VignetteBuilder: | knitr |
| SystemRequirements: | PureseqTM (https://github.com/PureseqTM/pureseqTM_package) |
| LinkingTo: | Rcpp |
| NeedsCompilation: | yes |
| Packaged: | 2023-04-06 13:18:26 UTC; richel |
| Author: | Richèl J.C. Bilderbeek
|
| Maintainer: | Richèl J.C. Bilderbeek <richel@richelbilderbeek.nl> |
| Repository: | CRAN |
| Date/Publication: | 2023-04-06 13:40:02 UTC |
Are the sequences transmembrance helices?
Description
Are the sequences transmembrance helices?
Usage
are_tmhs(protein_sequences, folder_name = get_default_pureseqtm_folder())
Arguments
protein_sequences |
one ore more protein sequence,
each sequence with the amino acids as capitals, for
example |
folder_name |
superfolder of PureseqTM.
The superfolder's name is |
Value
a vector of booleans of the same length as the number of sequences. The ith element is TRUE if the ith protein sequence is a transmembrane helix
Author(s)
Richèl J.C. Bilderbeek
Examples
if (is_pureseqtm_installed()) {
sequences <- c(
"QEKNWSALLTAVVIILTIAGNILVIMAVSLEKKLQNATNYFLM",
"VVIILTIRGNILVIMAVSLE"
)
are_tmhs(sequences)
}
Determine if these are all valid protein sequences
Description
Determine if these are all valid protein sequences, as can be used in topology prediction
Usage
are_valid_protein_sequences(protein_sequences, verbose = FALSE)
Arguments
protein_sequences |
one ore more protein sequence,
each sequence with the amino acids as capitals, for
example |
verbose |
set to TRUE for more output |
Value
TRUE if the protein sequence is valid
Calculate the the distance for each amino acid to the center of the TMH
Description
Calculate the the distance for each amino acid to the center of the TMH
Usage
calc_distance_to_tmh_center_from_topology(topology)
Arguments
topology |
the topology as a tibble with the columns 'name' and 'topology', where the 'name' column hold all the proteins' names, and 'topology' contains the respective topologies as strings. |
Value
a tibble with the columns 'name' and 'position' and 'distance_to_tmh_center'
Author(s)
Richèl J.C. Bilderbeek
Calculate the the distance for each amino acid to the center of the TMH
Description
Calculate the the distance for each amino acid to the center of the TMH
Usage
calc_distance_to_tmh_center_from_topology_str(topology_str)
Arguments
topology_str |
the topology as a string,
for example |
Value
a tibble with the columns 'position' and 'distance_to_tmh_center'
Author(s)
Richèl J.C. Bilderbeek
Use Rcpp to calculate the distance to a TMH center
Description
Use Rcpp to calculate the distance to a TMH center
Usage
calc_distance_to_tmh_center_from_topology_str_cpp_stl(topology_str)
Arguments
topology_str |
a topology as a string |
Value
a vector with distances
Check one protein sequence
Description
Will stop if the protein sequence is invalid, with a helpful error message.
Usage
check_protein_sequence(protein_sequence)
Arguments
protein_sequence |
a protein sequence, with
the amino acids as capitals, for
example |
Details
A protein sequence is invalid if:
it has zero, two or more sequences
the sequence contains zero, 1 or 2 amino acids
the sequence contains characters that are not in the amino acid uppercase alphabet, that is
ACDEFGHIKLMNPQRSTVWY
Value
nothing. Will stop if the protein sequence is invalid, with a helpful error message.
Examples
check_protein_sequence("FAMILYVW")
Check one or more protein sequences
Description
Will stop if the protein sequence is invalid, with a helpful error message.
Usage
check_protein_sequences(protein_sequences)
Arguments
protein_sequences |
one ore more protein sequence,
each sequence with the amino acids as capitals, for
example |
Details
A protein sequence is invalid if:
it has zero, two or more sequences
the sequence contains zero, 1 or 2 amino acids
the sequence contains characters that are not in the amino acid uppercase alphabet, that is
ACDEFGHIKLMNPQRSTVWY
Value
nothing. Will stop at the first invalid protein sequence, with a helpful error message.
Examples
check_protein_sequences(c("FAMILYVW", "FAMILYVW"))
Checks the installation of PureseqTM. Throws a helpful error message if incomplete, else does nothing
Description
Checks the installation of PureseqTM. Throws a helpful error message if incomplete, else does nothing
Usage
check_pureseqtm_installation(folder_name = get_default_pureseqtm_folder())
Arguments
folder_name |
superfolder of PureseqTM.
The superfolder's name is |
Value
Nothing. Will stop with a helpful error message if PureseqTM is not installed.
Author(s)
Richèl J.C. Bilderbeek
Examples
if (is_pureseqtm_installed()) {
check_pureseqtm_installation()
}
Check if the topology is valid.
Description
Check if the argument is of the same type as a predicted topology, as can be created with predict_topology. Will stop if not.
Usage
check_topology(topology)
Arguments
topology |
the topology as a tibble with the columns 'name' and 'topology', where the 'name' column hold all the proteins' names, and 'topology' contains the respective topologies as strings. |
Value
Nothing. Will stop with a helpful error message if the topology is invalid.
Author(s)
Richèl J.C. Bilderbeek
Examples
if (is_pureseqtm_installed()) {
fasta_filename <- get_example_filename("1bhaA.fasta")
topology <- predict_topology(fasta_filename)
check_topology(topology)
}
Check if the topology string is valid. Will stop if not.
Description
Check if the topology string is valid. Will stop if not.
Usage
check_topology_str(topology_str)
Arguments
topology_str |
the topology as a string,
for example |
Value
Nothing. Will stop with a helpful error message if the topology is invalid.
Author(s)
Richèl J.C. Bilderbeek
Examples
check_topology_str("0000000000000000000000000011111111111111111100000")
Convert a TMHMM topology to a PureseqTM topology
Description
Convert a TMHMM topology to a PureseqTM topology
Usage
convert_tmhmm_to_pureseqtm_topology(tmhmm_topology)
Arguments
tmhmm_topology |
topology as used by |
Value
a tibble with column names
name and topology, as can be checked by check_topology
Author(s)
Richèl J.C. Bilderbeek
Examples
tmhmm_topo_filename <- system.file(
"extdata", "UP000005640_9606_no_u.tmhmm", package = "pureseqtmr"
)
tmhmm_topology <- load_topology_file_as_tibble(tmhmm_topo_filename)
convert_tmhmm_to_pureseqtm_topology(tmhmm_topology)
Count the number of TMHs in a topology
Description
Count the number of TMHs in a topology
Usage
count_n_tmhs(topology_strs)
Arguments
topology_strs |
the topologies as zero, one oor more strings,
for example |
Examples
count_n_tmhs("00000000000000000000000000")
count_n_tmhs("00000000001111100000000000")
count_n_tmhs(c("0", "1"))
Create the five PureseqTM output files, by running PureseqTM.
Description
Create the five PureseqTM output files, by running PureseqTM.
Usage
create_pureseqtm_files(
fasta_filename,
folder_name = get_default_pureseqtm_folder(),
temp_folder_name = tempfile(pattern = "pureseqt_")
)
Arguments
fasta_filename |
path to a FASTA file |
folder_name |
superfolder of PureseqTM.
The superfolder's name is |
temp_folder_name |
path of a temporary folder. The folder does not need to exist. Files that are out in this folder are not automatically deleted, which is not a problem, as the default path given by tempdir is automatically cleaned by the operating system |
Value
full path to the files created
Author(s)
Richèl J.C. Bilderbeek
Examples
if (is_pureseqtm_installed()) {
fasta_filename <- get_example_filename("1bhaA.fasta")
create_pureseqtm_files(fasta_filename)
}
Create the output file of a PureseqTM proteome run
Description
Create the output file of a PureseqTM proteome run
Usage
create_pureseqtm_proteome_file(
fasta_filename,
topology_filename = tempfile(fileext = ".top"),
folder_name = get_default_pureseqtm_folder()
)
Arguments
fasta_filename |
path to a FASTA file |
topology_filename |
name of the file to save a protein's topology to |
folder_name |
superfolder of PureseqTM.
The superfolder's name is |
Value
the filename
Author(s)
Richèl J.C. Bilderbeek
Examples
if (is_pureseqtm_installed()) {
fasta_filename <- get_example_filename("1bhaA.fasta")
create_pureseqtm_proteome_file(fasta_filename)
}
This function does nothing. It is intended to inherit is parameters' documentation.
Description
This function does nothing. It is intended to inherit is parameters' documentation.
Usage
default_params_doc(
download_url,
fasta_filename,
fasta_file_text,
folder_name,
protein_sequence,
protein_sequences,
pureseqtm_filename,
pureseqtm_proteome_text,
pureseqtm_result,
pureseqtm_url,
temp_fasta_filename,
temp_folder_name,
tmhmm_topology,
topology,
topology_filename,
topology_str,
topology_strs,
verbose
)
Arguments
download_url |
the URL to download PureseqTM from |
fasta_filename |
path to a FASTA file |
fasta_file_text |
text of a FASTA file |
folder_name |
superfolder of PureseqTM.
The superfolder's name is |
protein_sequence |
a protein sequence, with
the amino acids as capitals, for
example |
protein_sequences |
one ore more protein sequence,
each sequence with the amino acids as capitals, for
example |
pureseqtm_filename |
filename to write the PureseqTM results to |
pureseqtm_proteome_text |
the output of a call
to |
pureseqtm_result |
the result of a PureseqTM run |
pureseqtm_url |
URL of the PureseqTM git repository |
temp_fasta_filename |
temporary FASTA filename, which will deleted after usage |
temp_folder_name |
path of a temporary folder. The folder does not need to exist. Files that are out in this folder are not automatically deleted, which is not a problem, as the default path given by tempdir is automatically cleaned by the operating system |
tmhmm_topology |
topology as used by |
topology |
the topology as a tibble with the columns 'name' and 'topology', where the 'name' column hold all the proteins' names, and 'topology' contains the respective topologies as strings. |
topology_filename |
name of the file to save a protein's topology to |
topology_str |
the topology as a string,
for example |
topology_strs |
the topologies as zero, one oor more strings,
for example |
verbose |
set to TRUE for more output |
Note
This is an internal function, so it should be marked with
@noRd. This is not done, as this will disallow all
functions to find the documentation parameters
Author(s)
Richèl J.C. Bilderbeek
Get the path to the folder where this package installs PureseqTM by default
Description
Get the path to the folder where this package installs PureseqTM by default
Usage
get_default_pureseqtm_folder()
Value
the path to the folder where this package installs PureseqTM by default
Author(s)
Richèl J.C. Bilderbeek
Examples
get_default_pureseqtm_folder()
Get the full path to a PureseqTM example file.
Description
Get the full path to a PureseqTM example file. If the filename specified is not a PureseqTM example file, this function will stop
Usage
get_example_filename(filename, folder_name = get_default_pureseqtm_folder())
Arguments
filename |
name of the example file, without the path |
folder_name |
superfolder of PureseqTM.
The superfolder's name is |
Value
the full path to a PureseqTM example file
Author(s)
Richèl J.C. Bilderbeek
See Also
use get_example_filenames to get all PureseqTM example filenames
Examples
if (is_pureseqtm_installed()) {
get_example_filename("1bhaA.fasta")
}
Get the full path to all PureseqTM example files
Description
Get the full path to all PureseqTM example files
Usage
get_example_filenames(folder_name = get_default_pureseqtm_folder())
Arguments
folder_name |
superfolder of PureseqTM.
The superfolder's name is |
Value
a character vector with all PureseqTM example files
Author(s)
Richèl J.C. Bilderbeek
See Also
use get_example_filename to get the full path to a PureseqTM example file
Examples
if (is_pureseqtm_installed()) {
get_example_filenames()
}
Get the URL of the PureseqTM source code
Description
Get the URL of the PureseqTM source code
Usage
get_pureseqtm_url()
Value
a URL as a character vector of one element
Author(s)
Richèl J.C. Bilderbeek
Examples
get_pureseqtm_url()
Get the PureseqTM version
Description
Get the PureseqTM version
Usage
get_pureseqtm_version(folder_name = get_default_pureseqtm_folder())
Arguments
folder_name |
superfolder of PureseqTM.
The superfolder's name is |
Value
a version number as a character vector of one element,
for example v0.10
Author(s)
Richèl J.C. Bilderbeek
Examples
if (is_pureseqtm_installed()) {
get_pureseqtm_version()
}
Install PureseqTM to a local folder
Description
Install PureseqTM to a local folder
Usage
install_pureseqtm(
folder_name = get_default_pureseqtm_folder(),
pureseqtm_url = get_pureseqtm_url()
)
Arguments
folder_name |
superfolder of PureseqTM.
The superfolder's name is |
pureseqtm_url |
URL of the PureseqTM git repository |
Value
Nothing.
Author(s)
Richèl J.C. Bilderbeek
Examples
## Not run:
install_pureseqtm()
## End(Not run)
Determines if the environment is AppVeyor
Description
Determines if the environment is AppVeyor
Usage
is_on_appveyor()
Value
TRUE if run on AppVeyor, FALSE otherwise
Author(s)
Richèl J.C. Bilderbeek
Examples
if (is_on_appveyor()) {
message("Running on AppVeyor")
}
Determines if the environment is a continuous integration service
Description
Determines if the environment is a continuous integration service
Usage
is_on_ci()
Value
TRUE if run on AppVeyor or Travis CI, FALSE otherwise
Author(s)
Richèl J.C. Bilderbeek
Examples
if (is_on_ci()) {
message("Running on a continuous integration service")
}
Determines if the environment is GitHub Actions
Description
Determines if the environment is GitHub Actions
Usage
is_on_github_actions()
Value
TRUE if run on GitHub Actions, FALSE otherwise
Author(s)
Richèl J.C. Bilderbeek
Examples
if (is_on_github_actions()) {
message("Running on GitHub Actions")
}
Determines if the environment is Travis CI
Description
Determines if the environment is Travis CI
Usage
is_on_travis()
Value
TRUE if run on Travis CI, FALSE otherwise
Author(s)
Richèl J.C. Bilderbeek
Examples
if (is_on_ci()) {
message("Running on Travis CI")
}
Is the line of text the name of a protein, as used within a FASTA filename?
Description
Is the line of text the name of a protein, as used within a FASTA filename?
Usage
is_protein_name_line(line)
Arguments
line |
line of text from a FASTA filename |
Value
TRUE if the line can be the name of a protein in a FASTA file
Author(s)
Richèl J.C. Bilderbeek
Examples
is_protein_name_line(">5H2A_CRIGR")
Measure if PureseqTM is installed locally
Description
Measure if PureseqTM is installed locally
Usage
is_pureseqtm_installed(folder_name = get_default_pureseqtm_folder())
Arguments
folder_name |
superfolder of PureseqTM.
The superfolder's name is |
Value
TRUE is PureseqTM is installed locally, FALSE otherwise
Author(s)
Richèl J.C. Bilderbeek
Examples
is_pureseqtm_installed()
Determine if the protein sequence contains at least one transmembrane helix.
Description
Determine if the protein sequence contains at least one transmembrane helix.
Usage
is_tmh(protein_sequence, folder_name = get_default_pureseqtm_folder())
Arguments
protein_sequence |
a protein sequence, with
the amino acids as capitals, for
example |
folder_name |
superfolder of PureseqTM.
The superfolder's name is |
Value
TRUE if the protein sequence contains at least one transmembrane helix
Author(s)
Richèl J.C. Bilderbeek
Examples
if (is_pureseqtm_installed()) {
# This sequence is a TMH
is_tmh("QEKNWSALLTAVVIILTIAGNILVIMAVSLEKKLQNATNYFLM")
# This sequence is not a TMH
is_tmh("VVIILTIRGNILVIMAVSLE")
}
Is the line of text the topology, as used within a FASTA filename?
Description
Is the line of text the topology, as used within a FASTA filename? In this context, a topology is a string of zeroes and ones, in which a one denotes that that amino acid is within the membrane.
Usage
is_topology_line(line)
Arguments
line |
line of text from a FASTA filename |
Value
TRUE if the line can be the text of a topology in a FASTA file.
Author(s)
Richèl J.C. Bilderbeek
Examples
# This is a valid topology
is_topology_line("000010101011")
# This is an invalid topology
is_topology_line("invalid")
Determine if this a valid protein sequence
Description
Determine if this is a valid protein sequence, as can be used in topology prediction
Usage
is_valid_protein_sequence(protein_sequence, verbose = FALSE)
Arguments
protein_sequence |
a protein sequence, with
the amino acids as capitals, for
example |
verbose |
set to TRUE for more output |
Value
TRUE if the protein sequence is valid
Parse a FASTA file to a table
with a name and sequence column
Description
Parse a FASTA file to a table
with a name and sequence column
Usage
load_fasta_file_as_tibble(fasta_filename)
Arguments
fasta_filename |
path to a FASTA file |
Value
a tibble
with a name and sequence column
See Also
use load_fasta_file_as_tibble_cpp to directly call the C++ function that does the actual work. Use load_fasta_file_as_tibble_r to call the (approx ten thousand times slower) R function
Parse a FASTA file to a table
with a name and sequence column
Description
Parse a FASTA file to a table
with a name and sequence column
Usage
load_fasta_file_as_tibble_cpp(fasta_filename)
Arguments
fasta_filename |
path to a FASTA file |
Value
a tibble
with a name and sequence column
Use Rcpp to load a FASTA file
Description
Use Rcpp to load a FASTA file
Usage
load_fasta_file_as_tibble_cpp_raw(fasta_filename)
Arguments
fasta_filename |
FASTA filename |
Value
a list with two character vectors, named 'name' and 'sequence'
Parse a FASTA file to a table
with a name and sequence column
Description
Parse a FASTA file to a table
with a name and sequence column
Usage
load_fasta_file_as_tibble_r(fasta_filename)
Arguments
fasta_filename |
path to a FASTA file |
Value
a tibble
with a name and sequence column
Parse a topology (.topo) file to a table
with a name and topology column
Description
Parse a topology (.topo) file to a table
with a name and topology column
Usage
load_topology_file_as_tibble(topology_filename)
Arguments
topology_filename |
name of the file to save a protein's topology to |
Value
a tibble
with a name and topology column,
as can be checked by check_topology
Examples
topology_filename <- system.file(
"extdata", "100507436.topo", package = "pureseqtmr"
)
load_topology_file_as_tibble(topology_filename)
Do a mock prediction directy on a protein sequence, as can be useful in testing Use predict_topologies_from_sequences for doing a real prediction.
Description
Do a mock prediction directy on a protein sequence, as can be useful in testing Use predict_topologies_from_sequences for doing a real prediction.
Usage
mock_predict_topologies_from_sequences(protein_sequences)
Arguments
protein_sequences |
one ore more protein sequence,
each sequence with the amino acids as capitals, for
example |
Value
a topology as a string of zeroes and ones, where a one denotes that the corresponding amino acid is located within the membrane.
Author(s)
Richèl J.C. Bilderbeek
Examples
protein_sequence <- paste0(
"QEKNWSALLTAVVIILTIAGNILVIMAVSLEKKLQNATNYFLM",
"SLAIADMLLGFLVMPVSMLTILYGYRWP"
)
mock_predict_topologies_from_sequences(protein_sequence)
Do a mock prediction of the topology of proteins
Description
Uses predict_topology for doing a real prediction
Usage
mock_predict_topology(fasta_filename)
Arguments
fasta_filename |
path to a FASTA file |
Value
a tibble with the columns 'name' and 'topology', where the 'name' column hold all the proteins' names, and 'topology' contains all respective topologies.
Author(s)
Richèl J.C. Bilderbeek
Examples
fasta_filename <- tempfile()
save_tibble_as_fasta_file(
t = tibble::tibble(
name = c("A", "B"),
sequence = c("FAMILYVW", "VWFAMILY")
),
fasta_filename = fasta_filename
)
mock_predict_topology(fasta_filename)
Parse the output of a call to PureseqTM_proteome.sh
Description
Parse the output of a call to PureseqTM_proteome.sh
Usage
parse_pureseqtm_proteome_text(pureseqtm_proteome_text)
Arguments
pureseqtm_proteome_text |
the output of a call
to |
Plot the topology
Description
Plot the topology
Usage
plot_topology(topology)
Arguments
topology |
the topology as a tibble with the columns 'name' and 'topology', where the 'name' column hold all the proteins' names, and 'topology' contains the respective topologies as strings. |
Value
a ggplot that displays the topology of one or more proteins
Author(s)
Richèl J.C. Bilderbeek
Examples
if (is_pureseqtm_installed() && is_on_ci()) {
fasta_filename <- get_example_filename("test_proteome.fasta")
topology <- predict_topology(fasta_filename)
plot_topology(topology)
}
Run PureseqTM directy on a protein sequence
Description
Run PureseqTM directy on a protein sequence
Usage
predict_topologies_from_sequences(
protein_sequences,
folder_name = get_default_pureseqtm_folder(),
temp_fasta_filename = tempfile(fileext = ".fasta")
)
Arguments
protein_sequences |
one ore more protein sequence,
each sequence with the amino acids as capitals, for
example |
folder_name |
superfolder of PureseqTM.
The superfolder's name is |
temp_fasta_filename |
temporary FASTA filename, which will deleted after usage |
Value
a topology as a string of zeroes and ones, where a one denotes that the corresponding amino acid is located within the membrane.
Author(s)
Richèl J.C. Bilderbeek
See Also
use mock_predict_topologies_from_sequences to mock the prediction of protein sequences, as can be useful in testing
Examples
if (is_pureseqtm_installed()) {
protein_sequence <- paste0(
"QEKNWSALLTAVVIILTIAGNILVIMAVSLEKKLQNATNYFLM",
"SLAIADMLLGFLVMPVSMLTILYGYRWP"
)
predict_topology_from_sequence(protein_sequence)
}
Predict the topology of proteins from file
Description
Predict the topology of zero, one or more proteins, of which the names and sequences are stored in the FASTA format
Usage
predict_topology(
fasta_filename,
folder_name = get_default_pureseqtm_folder(),
topology_filename = tempfile(fileext = ".top")
)
Arguments
fasta_filename |
path to a FASTA file |
folder_name |
superfolder of PureseqTM.
The superfolder's name is |
topology_filename |
name of the file to save a protein's topology to |
Value
a tibble with the columns 'name' and 'topology', where the 'name' column hold all the proteins' names, and 'topology' contains all respective topologies.
Note
unlike PureseqTM, the topologies predicted are returned in the same order as the original sequences. A bugreport is posted at the PureseqTM GitHub repository at https://github.com/PureseqTM/PureseqTM_Package/issues/11
Author(s)
Richèl J.C. Bilderbeek
See Also
use mock_predict_topology to do a mock prediction, as can be useful in testing
Examples
if (is_pureseqtm_installed()) {
fasta_filename <- get_example_filename("1bhaA.fasta")
predict_topology(fasta_filename)
}
Run PureseqTM directy on a protein sequence
Description
Will stop if the protein sequence is shorter than three amino acids.
Usage
predict_topology_from_sequence(
protein_sequence,
folder_name = get_default_pureseqtm_folder(),
temp_fasta_filename = tempfile(fileext = ".fasta")
)
Arguments
protein_sequence |
a protein sequence, with
the amino acids as capitals, for
example |
folder_name |
superfolder of PureseqTM.
The superfolder's name is |
temp_fasta_filename |
temporary FASTA filename, which will deleted after usage |
Value
a topology as a string of zeroes and ones, where a one denotes that the corresponding amino acid is located within the membrane.
Author(s)
Richèl J.C. Bilderbeek
Examples
if (is_pureseqtm_installed()) {
protein_sequence <- paste0(
"QEKNWSALLTAVVIILTIAGNILVIMAVSLEKKLQNATNYFLM",
"SLAIADMLLGFLVMPVSMLTILYGYRWP"
)
predict_topology_from_sequence(protein_sequence)
}
pureseqtmr: estimate the topoplogy of membrane proteins
Description
Proteins reside in either the cell plasma of in the cell membrane. A membrane protein goes through the membrane at least once. There are multiple ways to span this hydrophobic layer. One common structure is the transmembrane (alpha) helix (TMH). Given the amino acid sequence of a membrane protein, this package predicts which parts of the protein are TMHs
Author(s)
Richèl J.C. Bilderbeek
Examples
if (is_pureseqtm_installed()) {
# Obtain an example filename
fasta_filename <- get_example_filename("1bhaA.fasta")
# Get the topology as a tibble
topology <- predict_topology(fasta_filename)
# show the topology
plot_topology(topology)
}
Create a pureseqtmr report, to be used when reporting bugs
Description
Create a pureseqtmr report, to be used when reporting bugs
Usage
pureseqtmr_report(folder_name = get_default_pureseqtm_folder())
Arguments
folder_name |
superfolder of PureseqTM.
The superfolder's name is |
Value
Nothing.
Author(s)
Richèl J.C. Bilderbeek
Examples
pureseqtmr_report()
Run PureseqTM on a proteome
Description
Run PureseqTM on a proteome
Usage
run_pureseqtm_proteome(
fasta_filename,
folder_name = get_default_pureseqtm_folder(),
topology_filename = tempfile(fileext = ".top")
)
Arguments
fasta_filename |
path to a FASTA file |
folder_name |
superfolder of PureseqTM.
The superfolder's name is |
topology_filename |
name of the file to save a protein's topology to |
Value
the topology of the proteome, using the same output as PureseqTM. Use predict_topology to get the topology as a tibble
Author(s)
Richèl J.C. Bilderbeek
See Also
-
Use predict_topology to predict the topology of a proteome
-
Use create_pureseqtm_files to only create the PureseqTM output files
Examples
if (is_pureseqtm_installed()) {
fasta_filename <- get_example_filename("1bhaA.fasta")
run_pureseqtm_proteome(fasta_filename)
}
Save the first two columns of a tibble as a FASTA file
Description
Save the first two columns of a tibble as a FASTA file
Usage
save_tibble_as_fasta_file(t, fasta_filename)
Arguments
t |
a tibble |
fasta_filename |
path to a FASTA file |
Author(s)
Richèl J.C. Bilderbeek
Count the number of transmembrane helices in a topology
Description
Count the number of transmembrane helices in a topology
Usage
tally_tmhs(topology)
Arguments
topology |
the topology as a tibble with the columns 'name' and 'topology', where the 'name' column hold all the proteins' names, and 'topology' contains the respective topologies as strings. |
Value
a tibble with the number of TMHs per protein
Examples
if (is_pureseqtm_installed()) {
tally_tmhs(
predict_topology(
get_example_filename("1bhaA.fasta")
)
)
}
Uninstall PureseqTM
Description
Uninstall PureseqTM
Usage
uninstall_pureseqtm(folder_name = get_default_pureseqtm_folder())
Arguments
folder_name |
name of the folder
where the PureseqTM files are installed.
The name of the PureseqTM binary file will be at
|
Value
Nothing.
Author(s)
Richèl J.C. Bilderbeek